General Information

  • ID:  hor005209
  • Uniprot ID:  P24858
  • Protein name:  Diuretic hormone 2
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SFSVNPAVDILQHRYMEKVAQNNRNFLNRV
  • Length:  30(1-30)
  • Propeptide:  SFSVNPAVDILQHRYMEKVAQNNRNFLNRV
  • Signal peptide:  NA
  • Modification:  T30 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of fluid secretion;Prolonged ingestion of diuretic hormone 2 by M.sexta neonates results in reduced food consumption, slowed growth and reduced developmental rates and can be plant protection.
  • Mechanism:  Prolonged ingestion of diuretic hormone 2 by M.sexta neonates results in reduced food consumption, slowed growth and reduced developmental rates. A high percentage of neonates fail to molt into second instar larvae and death usually follows shortly thereafter, suggesting the possible use of this insecticidal peptide in plant protection.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P24858-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P24858-F1.pdbhor005209_AF2.pdbhor005209_ESM.pdb

Physical Information

Mass: 407848 Formula: C156H247N49O45S
Absent amino acids: CGTW Common amino acids: N
pI: 10.44 Basic residues: 5
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: -55.33 Boman Index: -7887
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 84.33
Instability Index: 3581 Extinction Coefficient cystines: 1490
Absorbance 280nm: 51.38

Literature

  • PubMed ID:  1764106
  • Title:  Effects of Manduca diuresin on neonates of the tobacco hornworm, Manduca sexta.